LL-37 — 4mg
For Research Use Only — Not for Human Use
Intended for laboratory research use only (e.g., analytical and in-vitro studies). Not for human use.
LL-37 is a human cathelicidin-derived antimicrobial peptide naturally produced by immune cells, epithelial cells, and various tissues.
It is the only known human cathelicidin and plays a significant role in innate immune defense.
In research environments, LL-37 is studied for its interactions with microbial membranes, immune signaling pathways, wound environments, and inflammatory responses.
$179.99
-
Official retailer -
Quality guaranteed
-
Free delivery from $99
-
Free returns is available
What Is LL-37?
LL-37 is a human cathelicidin-derived antimicrobial peptide naturally produced by immune cells, epithelial cells, and various tissues.
It is the only known human cathelicidin and plays a significant role in innate immune defense.
In research environments, LL-37 is studied for its interactions with microbial membranes, immune signaling pathways, wound environments, and inflammatory responses.
GENIQ provides LL-37 exclusively for laboratory research—not for human or animal use.
Peptide Overview
LL-37 is a 37–amino acid cationic peptide commonly explored in immunology and microbiology research.
Studies often investigate how LL-37 may promote changes in:
| • Host-defense peptide activity |
| • Microbial membrane disruption in vitro |
| • Immune-cell signaling and cytokine regulation |
| • Wound-environment biochemical processes |
| • Epithelial and barrier-tissue responses |
| • Inflammatory pathway modulation |
| Observations are based strictly on in-vitro and non-clinical models. |
All findings remain limited to preclinical and in-vitro experimental environments.
History of LL-37
LL-37 was discovered in the late 1990s during research on human innate immunity.
It originates from the precursor protein hCAP18 (human cationic antimicrobial protein), which is produced by neutrophils and epithelial tissues.
When activated, hCAP18 is cleaved to form LL-37, the mature antimicrobial peptide.
Over time, LL-37 became a major focus of research in:
| • Antimicrobial activity studies |
| • Immunomodulation models |
| • Wound healing environments |
| • Inflammatory signaling pathways |
| • Tissue barrier defense research |
| Its broad involvement in innate immunity made it an important peptide for laboratory investigations. |
Peptide Structure
Sequence: [LL-37, 37 aa]
Certificates of Analysis
LL-37 — 4mg
Research Findings
Research involving LL-37 has highlighted several key areas:
| • Antimicrobial investigations: LL-37 is studied for its ability to interact with microbial membranes and disrupt bacterial integrity in vitro. |
| • Innate immune signaling: Research models evaluate changes in immune pathways, including cytokine behavior and cellular communication. |
| • Wound and tissue studies: LL-37 is used to explore biochemical activity in wound environments and epithelial-cell responses. |
| • Barrier and skin biology: Investigators examine how LL-37 interacts with keratinocytes and structural components of the skin. |
| • Inflammation and host-defense mechanisms: Research explores the peptide’s regulatory role in inflammation-related molecular pathways. |
| These findings reflect laboratory experiments only and do not indicate clinical effects. |
These findings reflect laboratory experiments only and do not indicate clinical outcomes.
References
2. Larrick J., et al. “Host-defense peptides and their antimicrobial properties.” Cellular Microbiology Reviews.
3. Tissue Defense Consortium. “LL-37 involvement in inflammatory and wound-related environments.”
4. Skin Biology Research Unit. “Epithelial interactions and regulatory behavior of LL-37.”
FAQ
Are GENIQ peptides pharmaceutical products?
No. They are not drugs, supplements, or therapeutic items. All compounds are provided strictly for laboratory research.
Who should purchase GENIQ research materials?
Qualified researchers, laboratories, and institutions working within applicable laws and regulations.
Do orders include COAs?
Yes. Each peptide includes a Certificate of Analysis confirming identity and purity testing when available for that lot.
What handling notes does GENIQ provide?
Only storage temperature and solvent-compatibility notes when listed on the product page. GENIQ does not provide guidance on preparation or application. Buyers follow their institution’s laboratory protocols.
Are these products for human use?
No. For Research Use Only — Not for Human Use. Not for human or animal consumption.
For Research Use Only — Not for Human Use
Sold exclusively as laboratory research materials. Not for human or animal consumption, clinical use, or household use.
Intended research use: Laboratory and in-vitro research, including analytical characterization and pathway / receptor-binding studies as applicable to this compound. Not for human consumption, clinical use, or diagnostic use on humans.
LL-37 is a human cathelicidin-derived antimicrobial peptide naturally produced by immune cells, epithelial cells, and various tissues.
It is the only known human cathelicidin and plays a significant role in innate immune defense.
In research environments, LL-37 is studied for its interactions with microbial membranes, immune signaling pathways, wound environments, and inflammatory responses.
