LL-37 — 4mg
LL-37 is a human cathelicidin-derived antimicrobial peptide naturally produced by immune cells, epithelial cells, and various tissues.
It is the only known human cathelicidin and plays a significant role in innate immune defense.
In research environments, LL-37 is studied for its interactions with microbial membranes, immune signaling pathways, wound environments, and inflammatory responses.
$179.99
-
Official retailer
-
Quality guaranteed
-
Free delivery from $99
-
Free returns is available
What Is LL-37?
LL-37 is a human cathelicidin-derived antimicrobial peptide naturally produced by immune cells, epithelial cells, and various tissues.
It is the only known human cathelicidin and plays a significant role in innate immune defense.
In research environments, LL-37 is studied for its interactions with microbial membranes, immune signaling pathways, wound environments, and inflammatory responses.
GENIQ provides LL-37 exclusively for laboratory research—not for human or animal use.
Peptide Overview
LL-37 is a 37–amino acid cationic peptide commonly explored in immunology and microbiology research.
Studies often investigate how LL-37 may promote changes in:
| • Host-defense peptide activity |
| • Microbial membrane disruption in vitro |
| • Immune-cell signaling and cytokine regulation |
| • Wound-environment biochemical processes |
| • Epithelial and barrier-tissue responses |
| • Inflammatory pathway modulation |
| Observations are based strictly on in-vitro and non-clinical models. |
All findings remain limited to preclinical and in-vitro experimental environments.
History of LL-37
LL-37 was discovered in the late 1990s during research on human innate immunity.
It originates from the precursor protein hCAP18 (human cationic antimicrobial protein), which is produced by neutrophils and epithelial tissues.
When activated, hCAP18 is cleaved to form LL-37, the mature antimicrobial peptide.
Over time, LL-37 became a major focus of research in:
| • Antimicrobial activity studies |
| • Immunomodulation models |
| • Wound healing environments |
| • Inflammatory signaling pathways |
| • Tissue barrier defense research |
| Its broad involvement in innate immunity made it an important peptide for laboratory investigations. |
Peptide Structure
Sequence: [LL-37, 37 aa]
Certificates of Analysis
LL-37 — 4mg
Research Findings
Research involving LL-37 has highlighted several key areas:
| • Antimicrobial investigations: LL-37 is studied for its ability to interact with microbial membranes and disrupt bacterial integrity in vitro. |
| • Innate immune signaling: Research models evaluate changes in immune pathways, including cytokine behavior and cellular communication. |
| • Wound and tissue studies: LL-37 is used to explore biochemical activity in wound environments and epithelial-cell responses. |
| • Barrier and skin biology: Investigators examine how LL-37 interacts with keratinocytes and structural components of the skin. |
| • Inflammation and host-defense mechanisms: Research explores the peptide’s regulatory role in inflammation-related molecular pathways. |
| These findings reflect laboratory experiments only and do not indicate clinical effects. |
These findings reflect laboratory experiments only and do not indicate clinical outcomes.
References
2. Larrick J., et al. “Host-defense peptides and their antimicrobial properties.” Cellular Microbiology Reviews.
3. Tissue Defense Consortium. “LL-37 involvement in inflammatory and wound-related environments.”
4. Skin Biology Research Unit. “Epithelial interactions and regulatory behavior of LL-37.”
FAQ
What type of research is LL-37 used for?
LL-37 is used in studies related to innate immunity, antimicrobial activity, epithelial biology, and inflammatory pathway modeling.
Does GENIQ provide a Certificate of Analysis?
Yes. Every GENIQ research peptide includes a COA confirming identity and purity.
Is LL-37 approved for human or veterinary use?
No. LL-37 is not FDA-approved and is not intended for human or animal administration.
Does GENIQ provide instructions on preparation, dosing, or application?
No. GENIQ does not offer any reconstitution or dosing guidance.
Who should handle this compound?
Only trained researchers within appropriate laboratory environments.
Research Use Only
All GENIQ compounds are intended strictly for laboratory research.
Not for human or animal consumption, medical use, or therapeutic application.
Nothing in this document should be interpreted as medical advice or as approval for use outside controlled scientific environments.
LL-37 is a human cathelicidin-derived antimicrobial peptide naturally produced by immune cells, epithelial cells, and various tissues.
It is the only known human cathelicidin and plays a significant role in innate immune defense.
In research environments, LL-37 is studied for its interactions with microbial membranes, immune signaling pathways, wound environments, and inflammatory responses.
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.